Geoalkalibacter subterraneus: GSUB_07670 Help Entry GSUB_07670        CDS       T03585                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gsb  Geoalkalibacter subterraneus Pathway gsb01100   Metabolic pathways gsb01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gsb00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GSUB_07670    00074 Mycolic acid biosynthesis     GSUB_07670   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GSUB_07670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N Ribosomal_L50 HLH Motif Other DBs NCBI-ProteinID:  AJF06445 UniProt:  A0A0B5FQR3 LinkDB All DBs Position 1674148..1674381 Genome browser AA seq 77 aa AA seqDB search MASIDERVKQIVAEQLGVEEDQVTTEASFMEDLGADSLDTVELVMALEEEFDIEISDEDA EKIQTVQDAVDYINEHS NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcttctatcgacgaacgagttaagcagattgtggcggaacagttgggtgttgaggag gatcaggtcaccacggaagcttctttcatggaagatcttggcgccgattcccttgatacg gttgaactggttatggcgttggaggaagaattcgatatcgaaatttccgatgaggacgcc gaaaaaatccagactgttcaggacgccgtcgattatatcaacgagcattcctga

DBGET integrated database retrieval system