Geoalkalibacter subterraneus: GSUB_16675 Help Entry GSUB_16675        CDS       T03585                                  Name (GenBank) hypothetical protein   KO K03530   DNA-binding protein HU-beta Organism gsb  Geoalkalibacter subterraneus Brite KEGG Orthology (KO) [BR:gsb00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gsb03032]     GSUB_16675    03036 Chromosome and associated proteins [BR:gsb03036]     GSUB_16675    03400 DNA repair and recombination proteins [BR:gsb03400]     GSUB_16675 DNA replication proteins [BR:gsb03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GSUB_16675 Chromosome and associated proteins [BR:gsb03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GSUB_16675 DNA repair and recombination proteins [BR:gsb03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GSUB_16675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-CCDC81_bac_2 HU-HIG HU-CCDC81_euk_2 Motif Other DBs NCBI-ProteinID:  AJF08141 UniProt:  A0A0B5FX14 LinkDB All DBs Position pGSUB1:complement(57299..57574) Genome browser AA seq 91 aa AA seqDB search MTKEDLIKGISEKAGVTKADAGKTIKAIEMIVLEKLQNDEKALLPGIGTFVVKERKARKG RNPATGESIDIPAAKYVGFKPLKNIREALND NT seq 276 nt NT seq  +upstreamnt  +downstreamnt gtgacaaaggaagatctgattaaaggtatttccgagaaggccggagtcaccaaggctgac gccggcaaaacaatcaaggcgatcgagatgattgtccttgaaaaactgcagaacgacgaa aaggctctcctgccaggcatcgggacctttgtggtcaaagagcgcaaggcacgaaaaggg cgcaatcccgcaaccggagaaagtatcgatattccggcagcgaaatacgtggggttcaag cccttgaaaaacattcgcgaagctttaaacgactaa

DBGET integrated database retrieval system