Geobacillus stearothermophilus: GT50_02575 Help Entry GT50_02575        CDS       T04043                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gse  Geobacillus stearothermophilus Pathway gse01100   Metabolic pathways gse01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gse00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GT50_02575    00074 Mycolic acid biosynthesis     GT50_02575   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GT50_02575 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding ACP_SdgA_C PP-binding_2 DUF1493 SAPS Motif Other DBs NCBI-ProteinID:  ALA69194 LinkDB All DBs Position complement(493003..493236) Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVDESQVTLEASFKDDLGADSLDIVELVMELEDEFNMEISDEEA EKIVTVGDAVNYIKSRL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggccgatgtattggaacgtgtaacgaaaatcatcgttgaccggctgggggttgacgaa tcgcaagtgacgctcgaggcgtcgtttaaggacgacctgggcgctgactcgctcgacatc gtcgaactcgtcatggaacttgaagacgaattcaacatggaaatttccgatgaagaggcg gaaaaaatcgtcacagtcggagacgctgtgaactacataaaaagtcgtctgtaa

DBGET integrated database retrieval system