Glycine soja (wild soybean): 114387224 Help Entry 114387224         CDS       T06057                                  Name (RefSeq) probable dynein light chain   KO K10418   dynein light chain LC8-type Organism gsj  Glycine soja (wild soybean) Pathway gsj04145   Phagocytosis gsj04517   IgSF CAM signaling gsj04814   Motor proteins Brite KEGG Orthology (KO) [BR:gsj00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     114387224  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     114387224   09142 Cell motility    04814 Motor proteins     114387224  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:gsj03037]     114387224    04812 Cytoskeleton proteins [BR:gsj04812]     114387224 Cilium and associated proteins [BR:gsj03037]  Motile cilia and associated proteins   Dynein arm    114387224 Cytoskeleton proteins [BR:gsj04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      114387224 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  114387224 NCBI-ProteinID:  XP_028203167 LinkDB All DBs Position 15:1263965..1265173 Genome browser AA seq 95 aa AA seqDB search MLEGKAVIEDTDMPDKMQIQAMASASEALDLYDVFDCTSIAAHIKKEFDTKYGSGWQCVV GSSFGCFFTHSKGTFVYFTLETLNFLIFKGASYLI NT seq 288 nt NT seq  +upstreamnt  +downstreamnt atgttggaaggtaaagctgtgatagaggatactgacatgccagataagatgcagatccaa gccatggcatccgcttctgaagctttggatctctatgatgtttttgattgcacatccatt gctgcccacataaaaaaggagtttgatacaaagtatggttctggatggcagtgtgtggtg ggatcaagttttgggtgttttttcacccattctaagggaactttcgtgtactttactctg gagactctcaatttcctcatcttcaaaggggcttcttatctcatctaa

DBGET integrated database retrieval system