Glycine soja (wild soybean): 114391133 Help Entry 114391133         CDS       T06057                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism gsj  Glycine soja (wild soybean) Pathway gsj03083   Polycomb repressive complex gsj04120   Ubiquitin mediated proteolysis gsj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:gsj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114391133    04120 Ubiquitin mediated proteolysis     114391133   09126 Chromosome    03083 Polycomb repressive complex     114391133  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gsj04131]     114391133    04121 Ubiquitin system [BR:gsj04121]     114391133    03036 Chromosome and associated proteins [BR:gsj03036]     114391133 Membrane trafficking [BR:gsj04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     114391133 Ubiquitin system [BR:gsj04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      114391133    Cul7 complex      114391133 Chromosome and associated proteins [BR:gsj03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      114391133   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      114391133 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1 Skp1_POZ BTB Methyltransf_16 Motif Other DBs NCBI-GeneID:  114391133 NCBI-ProteinID:  XP_028207928 LinkDB All DBs Position 16:complement(27341552..27343332) Genome browser AA seq 155 aa AA seqDB search MASTKKITLKSSDGEAFEVEEAVALESQTIKHMIEDDCADSGIPLPNVTSKILAKVIEYC KKHVEANSADEKPSEDVLKAWDVDFVNVDQATLFDLILAANYLNIKSLLDLTCQTVADMI KGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggcatcgactaagaagatcaccctgaagagttcggacggtgaggccttcgaggtggag gaggcggtggcgctggagtcgcagacgatcaagcacatgatcgaggacgactgcgccgac agtggaatccctctccccaatgtcaccagcaagattctggcgaaggttatcgagtactgc aagaagcacgttgaggcgaacagtgctgatgagaagcccagtgaggatgtgctcaaggct tgggacgtggatttcgtcaacgttgatcaggccactctcttcgatctcattctggctgca aactacttgaacatcaagagccttttggaccttacttgccagacagtagcagacatgatc aagggaaagactcctgaggaaattcgcaagacattcaacatcaagaatgacttcacccct gaggaagaggaggaagttcgtagggaaaaccaatgggcgtttgaataa

DBGET integrated database retrieval system