Glycine soja (wild soybean): 114400200 Help Entry 114400200         CDS       T06057                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism gsj  Glycine soja (wild soybean) Pathway gsj04016   MAPK signaling pathway - plant gsj04070   Phosphatidylinositol signaling system gsj04075   Plant hormone signal transduction gsj04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:gsj00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     114400200    04070 Phosphatidylinositol signaling system     114400200    04075 Plant hormone signal transduction     114400200  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     114400200  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:gsj01009]     114400200   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gsj04131]     114400200    03036 Chromosome and associated proteins [BR:gsj03036]     114400200   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gsj04147]     114400200 Protein phosphatases and associated proteins [BR:gsj01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      114400200 Membrane trafficking [BR:gsj04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     114400200 Chromosome and associated proteins [BR:gsj03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      114400200 Exosome [BR:gsj04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    114400200 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C EF-hand_11 UPF0154 DUF5580_M EFhand_Ca_insen Dockerin_1 RNA_pol_Rpb4 Caleosin MotA_activ FCaBP_EF-hand SPEF2_C SurA_N_3 PA_Ig-like Fe_hyd_lg_C DUF6279 PhageMin_Tail MecA_N Motif Other DBs NCBI-GeneID:  114400200 NCBI-ProteinID:  XP_028218336 LinkDB All DBs Position 19:22779929..22782664 Genome browser AA seq 149 aa AA seqDB search MADQLTDEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDE EVDEMIREADVDGDGQINYEEFVKVMMAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggatcaactcaccgatgaacagatctccgagttcaaggaagccttcagcttgttc gataaggacggcgatggttgcatcacaaccaaggagcttggaactgttatgcgttcattg gggcaaaacccaactgaggcagaactccaggacatgatcaatgaagtggatgctgatggg aatggtaccattgacttccctgagttcctaaacctcatggctaggaagatgaaggacact gattctgaggaggagctgaaagaggcattccgggttttcgacaaggatcagaatgggttc atctctgctgctgagctccgtcatgtgatgaccaacctcggggagaaactcaccgatgaa gaggtcgatgagatgattcgtgaggctgatgttgatggagatggccaaataaactacgag gagttcgttaaggtgatgatggccaagtga

DBGET integrated database retrieval system