Glycine soja (wild soybean): 114404106 Help Entry 114404106         CDS       T06057                                  Name (RefSeq) SKP1-like protein 1A   KO K03094   S-phase kinase-associated protein 1 Organism gsj  Glycine soja (wild soybean) Pathway gsj03083   Polycomb repressive complex gsj04120   Ubiquitin mediated proteolysis gsj04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:gsj00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     114404106    04120 Ubiquitin mediated proteolysis     114404106   09126 Chromosome    03083 Polycomb repressive complex     114404106  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gsj04131]     114404106    04121 Ubiquitin system [BR:gsj04121]     114404106    03036 Chromosome and associated proteins [BR:gsj03036]     114404106 Membrane trafficking [BR:gsj04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     114404106 Ubiquitin system [BR:gsj04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      114404106    Cul7 complex      114404106 Chromosome and associated proteins [BR:gsj03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      114404106   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      114404106 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Ribosomal_L1 DUF6396 Motif Other DBs NCBI-GeneID:  114404106 NCBI-ProteinID:  XP_028223017 LinkDB All DBs Position Unknown AA seq 133 aa AA seqDB search MALTKNITLKSLDVEAFEVEEAVAVKSQMIKHMIEDNYVDNKVPLPNATNKILAEVIKYC KKHVDANCTDEKPSEDELKAWEADFVKVDQVTLFDLILVRGYMLLRLEGLGLSMNKIFIV LVELQGSLLGYLA NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atggctttgacaaagaatatcacattgaagagtttggatgttgaggcatttgaggtggag gaggcagtggcagtgaagtcgcagatgatcaagcacatgatcgaggacaactatgttgac aacaaagttcctctccccaatgctactaacaagattctggcagaggttatcaagtattgc aagaagcatgttgatgccaattgcactgatgagaagcctagtgaggatgaacttaaggct tgggaagctgatttcgtcaaggtagatcaggtcacactctttgatctcattctagtgagg ggttacatgttgttgaggcttgaaggtttgggcttgagtatgaacaagatttttattgtg cttgtggaactgcaaggatccttgcttggttaccttgcctaa

DBGET integrated database retrieval system