Glycine soja (wild soybean): 114419955 Help Entry 114419955         CDS       T06057                                  Name (RefSeq) calcium-binding protein CP1-like   KO K02183   calmodulin Organism gsj  Glycine soja (wild soybean) Pathway gsj04016   MAPK signaling pathway - plant gsj04070   Phosphatidylinositol signaling system gsj04075   Plant hormone signal transduction gsj04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:gsj00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     114419955    04070 Phosphatidylinositol signaling system     114419955    04075 Plant hormone signal transduction     114419955  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     114419955  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:gsj01009]     114419955   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gsj04131]     114419955    03036 Chromosome and associated proteins [BR:gsj03036]     114419955   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gsj04147]     114419955 Protein phosphatases and associated proteins [BR:gsj01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      114419955 Membrane trafficking [BR:gsj04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     114419955 Chromosome and associated proteins [BR:gsj03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      114419955 Exosome [BR:gsj04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    114419955 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_6 EF-hand_8 EF_SSP120 Dockerin_1 SPARC_Ca_bdg Motif Other DBs NCBI-GeneID:  114419955 NCBI-ProteinID:  XP_028241582 LinkDB All DBs Position 7:complement(44193844..44194546) Genome browser AA seq 147 aa AA seqDB search MCPSASHFRPAFHVLDADHDGKISHDDLRAFYAGVGGEGDDVIGAMMTLADTNKDGFVEY EEFERVVAAERKPVGCGAMEDVFRVMDKDGDGKLSHRDLKTYMAWAGFSATDDDINAMIR FGGGDQNGGVTFDGLLRILALECSAAN NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atgtgcccttccgcctcccatttccgaccggcattccacgtcctcgacgccgaccacgac ggcaaaatcagccacgacgacctccgcgccttctacgccggagtcggcggagaaggagac gacgtgatcggggcaatgatgacgctggccgacaccaacaaggacgggttcgtggagtac gaggagttcgagcgcgtggtcgcggcggagagaaaacccgtggggtgtggggccatggag gacgtgttcagggtcatggacaaggacggcgacggcaagctcagccaccgcgacctgaag acttacatggcctgggctggcttttcggccaccgacgacgacatcaacgccatgatccgg ttcggcggcggcgaccaaaacggcggcgttacgttcgatggtttgcttcgtatattggcg cttgaatgttccgccgctaattaa

DBGET integrated database retrieval system