Geobacter sulfurreducens KN400: KN400_3056 Help Entry KN400_3056        CDS       T01940                                  Symbol ssb-2 Name (GenBank) single-strand-binding protein   KO K03111   single-strand DNA-binding protein Organism gsk  Geobacter sulfurreducens KN400 Pathway gsk03030   DNA replication gsk03430   Mismatch repair gsk03440   Homologous recombination Brite KEGG Orthology (KO) [BR:gsk00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     KN400_3056 (ssb-2)    03430 Mismatch repair     KN400_3056 (ssb-2)    03440 Homologous recombination     KN400_3056 (ssb-2)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gsk03032]     KN400_3056 (ssb-2)    03400 DNA repair and recombination proteins [BR:gsk03400]     KN400_3056 (ssb-2)    03029 Mitochondrial biogenesis [BR:gsk03029]     KN400_3056 (ssb-2) DNA replication proteins [BR:gsk03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     KN400_3056 (ssb-2) DNA repair and recombination proteins [BR:gsk03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     Other MMR factors      KN400_3056 (ssb-2)   TLS (translesion DNA synthesis) factors    Other SOS response factors     KN400_3056 (ssb-2) Mitochondrial biogenesis [BR:gsk03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA replication factors    Other Mitochondrial DNA replication factors     KN400_3056 (ssb-2) SSDB OrthologParalogGFIT Motif Pfam:  SSB OSB_SSB SSB_1 DUF3127 Motif Other DBs NCBI-ProteinID:  ADI85868 LinkDB All DBs Position 3313165..3313605 Genome browser AA seq 146 aa AA seqDB search MASLNKVMLIGNLGKDPEVRYTPAGTAVASFSLATTEKFKNRNGEFEEKTEWHNVVLWGR QAEIAGEYLAKGRTVFIEGRLQTRKWQDKDGRDRWTTEVVGERMQMLGGKGEGGGGRAGG RGGQESGFGGPSYDEPAFNPDDDIPF NT seq 441 nt NT seq  +upstreamnt  +downstreamnt atggccagtctcaacaaagtgatgctcatcggcaatctcgggaaggatcccgaggttcgc tacacgcctgccggcacggcagttgccagcttctcccttgccaccaccgaaaaattcaag aacaggaacggcgaattcgaggaaaagaccgaatggcacaacgtggtcctctggggccgc caggccgaaatcgccggtgaatacctggccaaggggcggaccgttttcatcgaggggcgg ctccagacccgcaagtggcaggacaaggatggtcgtgaccgctggaccaccgaggtggtg ggcgagcggatgcagatgctcggcggcaagggtgagggagggggcggacgcgcaggcgga cgcggcggccaggagagcggcttcggcggcccctcctatgacgagccggcgttcaacccg gacgacgacattccgttctag

DBGET integrated database retrieval system