Galdieria sulphuraria: Gasu_15850 Help Entry Gasu_15850        CDS       T02926                                  Name (RefSeq) dynein light chain LC8-type   KO K10418   dynein light chain LC8-type Organism gsl  Galdieria sulphuraria Pathway gsl04145   Phagocytosis gsl04517   IgSF CAM signaling gsl04814   Motor proteins Brite KEGG Orthology (KO) [BR:gsl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     Gasu_15850  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     Gasu_15850   09142 Cell motility    04814 Motor proteins     Gasu_15850  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:gsl03037]     Gasu_15850    04812 Cytoskeleton proteins [BR:gsl04812]     Gasu_15850 Cilium and associated proteins [BR:gsl03037]  Motile cilia and associated proteins   Dynein arm    Gasu_15850 Cytoskeleton proteins [BR:gsl04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      Gasu_15850 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light TINF2_N YtzJ Motif Other DBs NCBI-GeneID:  17089762 NCBI-ProteinID:  XP_005707601 UniProt:  M2W5M1 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MTSRVKLETSETSSEPKVVLKSSDMEQSKLEQTFQIAKEAISRFKVEKDVAAFIKKELDK NFGEYWHCVVGKSFGSYVTHVSGAFAYFYVDQLAVMVFKA NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgacttcaagagtgaaactggaaacctcagaaactagttcagagccaaaagtagttcta aaaagctcagacatggaacagtcgaaactagaacaaactttccaaattgcaaaagaggct atttcaaggtttaaagtggaaaaggacgttgccgcctttattaaaaaagagcttgacaaa aactttggtgaatattggcactgtgttgtcgggaagagctttggttcatatgttactcac gttagtggggcatttgcctatttttacgtagatcaactagcagtgatggttttcaaagct taa

DBGET integrated database retrieval system