KEGG   Gynuella sunshinyii: YC6258_00908
Entry
YC6258_00908      CDS       T03690                                 
Name
(GenBank) response regulator consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
  KO
K07657  two-component system, OmpR family, phosphate regulon response regulator PhoB
Organism
gsn  Gynuella sunshinyii
Pathway
gsn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gsn00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    YC6258_00908
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:gsn02022]
    YC6258_00908
Two-component system [BR:gsn02022]
 OmpR family
  PhoR-PhoB (phosphate starvation response)
   YC6258_00908
SSDB
Motif
Pfam: Response_reg Trans_reg_C PDE8A_N VpsR
Other DBs
NCBI-ProteinID: AJQ92958
UniProt: A0A0C5VHW5
LinkDB
Position
894758..895450
AA seq 230 aa
MSGKTILVVDDETPIREMIAAALEMAGYHCIEAGDAQEAMSVVVDQKPDLLLLDWMLPGS
SGVEICRRLKRDHLTAEIPVIMLTAKGEEDHKIQGLEAGADDYITKPFSPRELVARLKAV
LRRATPPGIEEAIEVNGLRLDPGSHRVSSNGQEIEMGPTEFRLLQFFMSHQERAYTRAQL
LDQVWGGNVYVDERTVDVHIRRLRKALGDQLMTMIQTVRGTGYRFSAKVS
NT seq 693 nt   +upstreamnt  +downstreamnt
atgtctggaaaaaccatactggtcgttgatgatgagacccccatccgcgaaatgattgcc
gcagcattggaaatggcgggttatcactgtattgaagcaggtgatgcacaggaagcgatg
tcagtggtagtggatcagaagccggacctgttattactggactggatgttacctggttcc
agtggcgtggaaatctgccgccggttgaaacgtgaccatctcactgccgagattccagtg
attatgttgactgccaagggagaggaagatcataaaattcagggattggaggccggtgct
gatgattatatcaccaagccgttttcccctcgtgaactggtggctcgtctgaaagctgtg
ctacgtcgggcaacccctcctggtatagaggaagcgattgaggtgaatggcctgagactt
gatccaggcagtcatcgggtcagctcgaatggacaggaaattgaaatgggccccacggag
ttcaggctgttacaattcttcatgagtcatcaggagcgggcctatacacgggcacagtta
ctggatcaggtctggggaggaaatgtatatgtggatgaacgtacggtcgatgtgcatatt
cgccgcctgcgcaaagctctcggtgaccagttgatgaccatgattcaaaccgtacgtgga
accggctatcgtttttctgccaaagttagctga

DBGET integrated database retrieval system