Geobacillus subterraneus: GS3922_08965 Help Entry GS3922_08965      CDS       T04323                                  Name (GenBank) spore coat protein   KO K06440   similar to spore coat protein Organism gsr  Geobacillus subterraneus Brite KEGG Orthology (KO) [BR:gsr00001]  09190 Not Included in Pathway or Brite   09193 Unclassified: signaling and cellular processes    99978 Cell growth     GS3922_08965 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DUF892 DUF1657 Motif Other DBs NCBI-ProteinID:  AMX83780 LinkDB All DBs Position 1829670..1829855 Genome browser AA seq 61 aa AA seqDB search MKAAGTHETLELHELLMFKNTCLAKSMAMRQMVIDPQLKSLIEQDIQKTTQHIRDLQNLL S NT seq 186 nt NT seq  +upstreamnt  +downstreamnt atgaaagcggcaggaacgcacgaaacactcgagttgcacgagctgctgatgtttaaaaac acatgcctcgccaaaagcatggccatgcggcaaatggtgatcgacccgcaactgaaatcg ctcatcgagcaagacatccaaaaaacaacgcagcatatccgcgacttgcaaaacttatta tcgtaa

DBGET integrated database retrieval system