Geobacillus subterraneus: GS3922_10565 Help Entry GS3922_10565      CDS       T04323                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gsr  Geobacillus subterraneus Pathway gsr01100   Metabolic pathways gsr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gsr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GS3922_10565    00074 Mycolic acid biosynthesis     GS3922_10565   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GS3922_10565 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 SAPS Motif Other DBs NCBI-ProteinID:  AMX84070 LinkDB All DBs Position complement(2159001..2159234) Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVDESQVTLEASFKDDLGADSLDIVELVMELEDEFNMEISDEEA EKIVTVGDAVNYIKSHL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcagacgtattggagcgtgtaacgaaaattattgtcgaccgcttaggggttgacgaa tcacaagtgacgcttgaggcgtcgttcaaagatgatttgggcgccgactcgctcgacatc gtcgaactggtcatggagctcgaagatgaattcaacatggaaatttccgatgaagaagcg gaaaaaatcgtcacagtcggagatgctgtgaactacataaaaagccatctgtaa

DBGET integrated database retrieval system