Geobacillus subterraneus: GS3922_13765
Help
Entry
GS3922_13765 CDS
T04323
Name
(GenBank) acetolactate synthase
KO
K01652
acetolactate synthase I/II/III large subunit [EC:
2.2.1.6
]
Organism
gsr
Geobacillus subterraneus
Pathway
gsr00290
Valine, leucine and isoleucine biosynthesis
gsr00650
Butanoate metabolism
gsr00660
C5-Branched dibasic acid metabolism
gsr00770
Pantothenate and CoA biosynthesis
gsr01100
Metabolic pathways
gsr01110
Biosynthesis of secondary metabolites
gsr01210
2-Oxocarboxylic acid metabolism
gsr01230
Biosynthesis of amino acids
Module
gsr_M00019
Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
gsr_M00570
Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:
gsr00001
]
09100 Metabolism
09101 Carbohydrate metabolism
00650 Butanoate metabolism
GS3922_13765
00660 C5-Branched dibasic acid metabolism
GS3922_13765
09105 Amino acid metabolism
00290 Valine, leucine and isoleucine biosynthesis
GS3922_13765
09108 Metabolism of cofactors and vitamins
00770 Pantothenate and CoA biosynthesis
GS3922_13765
Enzymes [BR:
gsr01000
]
2. Transferases
2.2 Transferring aldehyde or ketonic groups
2.2.1 Transketolases and transaldolases
2.2.1.6 acetolactate synthase
GS3922_13765
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
TPP_enzyme_C
TPP_enzyme_N
TPP_enzyme_M
CO_dh
Motif
Other DBs
NCBI-ProteinID:
AMX84625
UniProt:
A0ABN4NQ46
LinkDB
All DBs
Position
complement(2821511..2823151)
Genome browser
AA seq
546 aa
AA seq
DB search
MKKRIMRGLSVPQAIVECVKQEGVSHLFGVPGESYLPLLDALYDEPTLQFISTRHEGGAA
FMAEAYAKASGKPGVVLATRGVGAANLAIGVHTARQDSTPLVVLLGQVHRRFRGREGFQE
VELDEWFRPLAKWAVEITDPERVPELVQRAFRVAKTGRPGPVVVSIPEDVFTATVAEAVL
LAMDAPRPAPADDEVKRIEAALAAARRPLIVAGGGVKRARAEQALRRVAEQYSLPVAAAF
RRHDVFPHDHPLYVGHFGLGAPAAVVETAKQADLILAVGTRLSEVTTQDYTWPLPHQTLI
HIDIDEEALGKVFSADIAVAADAREALWALSGRQIVPSWNEWVSARRRAYEETARRPQPP
RNVQEAIIAELQVRLPDDGVITNDAGNFAGWLHTFFSFKERQLYIGPTSGAMGYGLPAAI
GAKLVHPERPVVSLSGDGGFLMTAAELETASRYGVPVISLVFNNRMYGTIRMYQELQFPG
RVVGSGLGEVSFAKLAMALGANGVTVGTVDEFAAAFKQALVAAKPTVIEVMTEPEQLSVT
MRLPGR
NT seq
1641 nt
NT seq
+upstream
nt +downstream
nt
atgaaaaagcggatcatgcgcggtctttccgtcccgcaggcaatcgtcgaatgtgtaaaa
caagagggtgtttctcatttgttcggcgtgccgggagaaagttatttgccgctgttggat
gcgttgtacgacgaaccgacgctccagttcatttccacccgccatgaaggcggggcggcg
tttatggctgaggcgtatgcgaaagcgtccggcaaaccgggcgttgtcctggcgacgcgt
ggggtcggcgcggccaatttggcgatcggggttcatacggcacgtcaagattcgacgccg
cttgtcgtcctgttaggacaagtgcaccgccgatttcgcggccgtgaaggctttcaagag
gtggaactagacgaatggtttcgtccgcttgcgaagtgggcggtcgagatcaccgaccct
gagcgcgttccagaacttgtgcaacgggcgtttcgggtggcgaaaacgggacggcccggg
ccggtggttgtctcgattccggaagatgtgtttacggcaacggtcgctgaggcagtgttg
ctggcgatggatgcgccgcgccccgctccggcggatgatgaggtgaaacggatcgaagcg
gcgctcgccgctgcccgccggccgctcattgtcgctggcggcggggtgaagcgggcgcgc
gctgagcaggcgctgcgccgcgtcgctgaacaatattcccttccggtcgctgccgcgttt
cgccgccatgacgtgtttccgcatgaccacccgctttatgtcggccacttcggtcttggc
gcaccggcggccgttgttgagacggccaagcaggcagatctgattttggcggtcggcacg
cggttgtcggaagtgacgacgcaagattatacatggccgctgccgcaccagacgctcatc
catatcgatatcgacgaggaggcgctcggcaaagtgttttccgcggacatcgctgtcgca
gccgacgcccgtgaagcattgtgggcgctgtcagggcggcagattgtcccgtcctggaac
gaatgggtctcggcgcgccggcgcgcctatgaggaaacagcaagacggccgcagccgccg
cgaaacgtgcaagaagccatcatcgccgagctgcaagtgcggctgccggatgacggcgtc
attacgaacgatgccggcaattttgccggctggctgcacacgtttttctcgttcaaggaa
cggcagctgtatatcggcccgacatcaggtgcgatgggatacgggctgccggccgccatc
ggtgcgaagcttgttcatccagagcggccggtcgtttcgctatcaggcgatggcgggttt
ctcatgacagcggccgaactggagaccgcgtcccgttatggcgtcccggtcatcagcctc
gtttttaacaatcggatgtacggaacgattcgcatgtatcaagagcttcagtttccggga
cgggtggtcggcagcggactgggtgaagtatcatttgcgaaattggctatggcgttaggc
gccaacggcgttacggtggggacggtcgatgagtttgccgctgcgtttaagcaggcgctt
gtcgcggcgaaaccgactgtgattgaggtgatgacagaaccggaacaattgtccgttacg
atgagacttccgggcagatga
DBGET
integrated database retrieval system