Gavia stellata (red-throated loon): 104250866 Help Entry 104250866         CDS       T08384                                  Symbol CALML4 Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism gste  Gavia stellata (red-throated loon) Pathway gste04020   Calcium signaling pathway gste04070   Phosphatidylinositol signaling system gste04114   Oocyte meiosis gste04218   Cellular senescence gste04261   Adrenergic signaling in cardiomyocytes gste04270   Vascular smooth muscle contraction gste04371   Apelin signaling pathway gste04625   C-type lectin receptor signaling pathway gste04744   Phototransduction gste04910   Insulin signaling pathway gste04912   GnRH signaling pathway gste04916   Melanogenesis Brite KEGG Orthology (KO) [BR:gste00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     104250866 (CALML4)    04020 Calcium signaling pathway     104250866 (CALML4)    04070 Phosphatidylinositol signaling system     104250866 (CALML4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104250866 (CALML4)    04218 Cellular senescence     104250866 (CALML4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104250866 (CALML4)   09152 Endocrine system    04910 Insulin signaling pathway     104250866 (CALML4)    04912 GnRH signaling pathway     104250866 (CALML4)    04916 Melanogenesis     104250866 (CALML4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     104250866 (CALML4)    04270 Vascular smooth muscle contraction     104250866 (CALML4)   09157 Sensory system    04744 Phototransduction     104250866 (CALML4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:gste01009]     104250866 (CALML4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gste04131]     104250866 (CALML4)    03036 Chromosome and associated proteins [BR:gste03036]     104250866 (CALML4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gste04147]     104250866 (CALML4) Protein phosphatases and associated proteins [BR:gste01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104250866 (CALML4) Membrane trafficking [BR:gste04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     104250866 (CALML4) Chromosome and associated proteins [BR:gste03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      104250866 (CALML4) Exosome [BR:gste04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    104250866 (CALML4) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_8 EF-hand_6 EF-hand_9 LisH_WDR26 HI0933_like_1st SAPC2_N EF_EFCAB10_C EF-hand_11 AIF-1 DUF5580_M ThsA_Macro HEAT_Ints3_C Motif Other DBs NCBI-GeneID:  104250866 NCBI-ProteinID:  XP_009810698 LinkDB All DBs Position Unknown AA seq 81 aa AA seqDB search MYRQMKQEEPEKEILTALSMIDRQKRGVITVSELRAKLTRLGEKLSEEEVDDLLKQAKIG PNGTIKYEEFVRIICLPTVDY NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atgtacaggcaaatgaagcaagaggaacccgagaaggaaatcctcacggccctgtctatg atagacaggcagaagagaggcgttatcaccgtttcagagctgcgagccaaacttacaaga ctaggagaaaagctttccgaggaagaagttgatgacctgctaaaacaagctaaaattgga ccaaacggaacaataaaatatgaagaatttgtccgcatcatctgtcttcctacagtcgac tactga

DBGET integrated database retrieval system