Gavia stellata (red-throated loon): 104251962 Help Entry 104251962         CDS       T08384                                  Symbol DYNLT3 Name (RefSeq) dynein light chain Tctex-type 3   KO K10420   dynein light chain Tctex-type 1/3 Organism gste  Gavia stellata (red-throated loon) Pathway gste04145   Phagocytosis gste04814   Motor proteins gste05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gste00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     104251962 (DYNLT3)   09142 Cell motility    04814 Motor proteins     104251962 (DYNLT3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104251962 (DYNLT3)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:gste03037]     104251962 (DYNLT3)    04812 Cytoskeleton proteins [BR:gste04812]     104251962 (DYNLT3) Cilium and associated proteins [BR:gste03037]  Motile cilia and associated proteins   Dynein arm    104251962 (DYNLT3) Cytoskeleton proteins [BR:gste04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      104251962 (DYNLT3) SSDB OrthologParalogGFIT Motif Pfam:  Tctex-1 Motif Other DBs NCBI-GeneID:  104251962 NCBI-ProteinID:  XP_009807867 LinkDB All DBs Position Unknown AA seq 106 aa AA seqDB search MIFNADEAHNIVKECIEGVLGKADYNHNKVNQWTAAIVEQSLTHLVKLGKTYKYIVTCAV MQRSGAGLHTASSCFWDTTTDGTCTVRWENRTMNCIVNVFAVAIIL NT seq 321 nt NT seq  +upstreamnt  +downstreamnt atgatcttcaatgctgatgaggctcacaacatagttaaggagtgcatagaaggtgttcta ggcaaggcagattataatcacaacaaagtcaaccagtggactgctgctatagtagaacag tcactgacacatctggtaaaacttggaaaaacatataagtacattgtaacctgtgcggtg atgcagaggagtggagctggtcttcacacagcaagctcatgcttctgggataccacaact gatggaacctgcacagtgagatgggaaaaccgaacaatgaactgcattgtcaatgtgttt gctgttgctattatcctgtag

DBGET integrated database retrieval system