Gavia stellata (red-throated loon): 104252255 Help Entry 104252255         CDS       T08384                                  Symbol PPP3R1 Name (RefSeq) calcineurin subunit B type 1   KO K06268   serine/threonine-protein phosphatase 2B regulatory subunit Organism gste  Gavia stellata (red-throated loon) Pathway gste04010   MAPK signaling pathway gste04020   Calcium signaling pathway gste04114   Oocyte meiosis gste04218   Cellular senescence gste04310   Wnt signaling pathway gste04370   VEGF signaling pathway gste04625   C-type lectin receptor signaling pathway Brite KEGG Orthology (KO) [BR:gste00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104252255 (PPP3R1)    04310 Wnt signaling pathway     104252255 (PPP3R1)    04370 VEGF signaling pathway     104252255 (PPP3R1)    04020 Calcium signaling pathway     104252255 (PPP3R1)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104252255 (PPP3R1)    04218 Cellular senescence     104252255 (PPP3R1)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104252255 (PPP3R1)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:gste01009]     104252255 (PPP3R1) Protein phosphatases and associated proteins [BR:gste01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      104252255 (PPP3R1) SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_FSTL1 EF_SSP120 EH SPARC_Ca_bdg EF-hand_9 RSA-1_C Motif Other DBs NCBI-GeneID:  104252255 NCBI-ProteinID:  XP_009813773 LinkDB All DBs Position Unknown AA seq 160 aa AA seqDB search MCSHFDADEIKRLGKRFKKLDLDNSGSLSVEEFMSLPELQQNPLVQRVIDIFDTDGNGEV DFKEFIEGVSQFSVKGDKEQKLRFAFRIYDMDKDGYISNGELFQVLKMMVGNNLKDTQLQ QIVDKTIINADKDGDGRISFEEFCAVVGGLDIHKKMVVDV NT seq 483 nt NT seq  +upstreamnt  +downstreamnt atgtgctcgcactttgatgctgatgagataaaacgactaggaaagagatttaagaagctt gatttggacaactctggttctttgagcgtggaagagttcatgtctttacctgaattgcaa cagaacccattagtacagcgagtaatagatatatttgacacggatggaaacggagaagta gacttcaaagaatttatagaaggagtctcgcagttcagtgtcaaaggagataaggaacag aagttgaggtttgcatttcgcatttatgatatggacaaagacggttatatctcaaatggc gagctcttccaggtgctgaagatgatggttgggaacaatctcaaagacactcagttacag caaattgtagataaaaccataattaatgcagataaggatggtgatggaagaatatccttt gaagaattctgtgctgttgtaggaggcctagatatccacaaaaagatggtcgtagacgtg tga

DBGET integrated database retrieval system