Gavia stellata (red-throated loon): 104254657 Help Entry 104254657         CDS       T08384                                  Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism gste  Gavia stellata (red-throated loon) Pathway gste04137   Mitophagy - animal gste04144   Endocytosis gste04145   Phagosome gste04148   Efferocytosis gste05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gste00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     104254657    04145 Phagosome     104254657    04137 Mitophagy - animal     104254657    04148 Efferocytosis     104254657  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104254657  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gste04131]     104254657   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gste04147]     104254657    04031 GTP-binding proteins [BR:gste04031]     104254657 Membrane trafficking [BR:gste04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     104254657  Endosome - Lysosome transport     104254657 Exosome [BR:gste04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104254657   Exosomal proteins of other body fluids (saliva and urine)    104254657   Exosomal proteins of colorectal cancer cells    104254657   Exosomal proteins of bladder cancer cells    104254657 GTP-binding proteins [BR:gste04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     104254657 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA MMR_HSR1 GTP_EFTU RsgA_GTPase AAA_16 MCR_beta Motif Other DBs NCBI-GeneID:  104254657 NCBI-ProteinID:  XP_009806794 LinkDB All DBs Position Unknown AA seq 177 aa AA seqDB search MANRGATRPNGPNAGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALAGNKADLANKRAVDFQEAQAYADDNSLLFMETSAKTSMNVNEIFMAI NT seq 532 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagacccaatgggccaaatgctggaaataaaatttgccag ttcaaacttgtacttttaggagagtctgcagttggcaaatcaagtttggtgcttcgtttt gtgaaaggacagtttcatgagtttcaagaaagtacgattggagctgcttttctaacccag actgtatgtcttgacgatacaacggtaaaatttgaaatttgggatacagctgggcaagag cggtaccacagtttagcacccatgtactacagaggagcacaagcagctatagtggtatac gacattacaaatgaggagtcctttgccagagcgaaaaattgggtcaaagaacttcagcga caagcaagtcctaacattgtaatagctttagcaggaaacaaagctgatctagctaacaaa agagctgtggatttccaggaagcacaggcttatgcagatgataacagtttattgttcatg gagacatctgccaaaacatctatgaacgtaaatgaaatattcatggcaattg

DBGET integrated database retrieval system