Gavia stellata (red-throated loon): 104256042 Help Entry 104256042         CDS       T08384                                  Name (RefSeq) insulin-like growth factor I   KO K05459   insulin-like growth factor 1 Organism gste  Gavia stellata (red-throated loon) Pathway gste04010   MAPK signaling pathway gste04068   FoxO signaling pathway gste04081   Hormone signaling gste04114   Oocyte meiosis gste04115   p53 signaling pathway gste04150   mTOR signaling pathway gste04510   Focal adhesion gste04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:gste00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104256042    04068 FoxO signaling pathway     104256042    04150 mTOR signaling pathway     104256042   09133 Signaling molecules and interaction    04081 Hormone signaling     104256042  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     104256042    04115 p53 signaling pathway     104256042   09144 Cellular community - eukaryotes    04510 Focal adhesion     104256042  09150 Organismal Systems   09152 Endocrine system    04914 Progesterone-mediated oocyte maturation     104256042  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gste04052]     104256042 Cytokines and neuropeptides [BR:gste04052]  Cytokines   Growth factors (RTK binding)    104256042 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  104256042 NCBI-ProteinID:  XP_009808638 LinkDB All DBs Position Unknown AA seq 88 aa AA seqDB search MEKINSLSTQLVKCCFCDFLKVKMHTVSYIHFFYLGLCLLTLTSSAAAGPETLCGAELVD ALQFVCGDRGFYFSKSTLSFIQLLNFSM NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atggaaaaaatcaacagtctttcaacacaattagttaagtgctgcttttgtgatttcttg aaggtgaagatgcacactgtgtcctacattcatttcttctaccttggcctgtgtttgctt accttaaccagttctgctgctgctggcccagaaacactttgtggtgctgagctggttgat gctcttcagttcgtgtgtggagacagaggcttttacttcagtaagtcaaccctttccttc attcaactgctgaacttttccatgtaa

DBGET integrated database retrieval system