Gavia stellata (red-throated loon): 104258627 Help Entry 104258627         CDS       T08384                                  Symbol CLDN1 Name (RefSeq) claudin-1   KO K06087   claudin Organism gste  Gavia stellata (red-throated loon) Pathway gste03272   Virion - Hepatitis viruses gste04382   Cornified envelope formation gste04514   Cell adhesion molecule (CAM) interaction gste04530   Tight junction Brite KEGG Orthology (KO) [BR:gste00001]  09120 Genetic Information Processing   09125 Information processing in viruses    03272 Virion - Hepatitis viruses     104258627 (CLDN1)  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04514 Cell adhesion molecule (CAM) interaction     104258627 (CLDN1)  09140 Cellular Processes   09144 Cellular community - eukaryotes    04530 Tight junction     104258627 (CLDN1)  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     104258627 (CLDN1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:gste03037]     104258627 (CLDN1)    04147 Exosome [BR:gste04147]     104258627 (CLDN1) Cilium and associated proteins [BR:gste03037]  Other cilia and associated proteins   Stereociliary proteins    104258627 (CLDN1) Exosome [BR:gste04147]  Exosomal proteins   Exosomal proteins of ovarian cancer cells    104258627 (CLDN1)   Exosomal proteins of colorectal cancer cells    104258627 (CLDN1) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PMP22_Claudin Claudin_2 DUF981 Cytochrom_B_C OppC_N DUF1218 CD20 Voltage_CLC HlyIII DUF7937 DUF4134 DUF7269 Motif Other DBs NCBI-GeneID:  104258627 NCBI-ProteinID:  XP_009812078 LinkDB All DBs Position Unknown AA seq 136 aa AA seqDB search SLQATRALMVAAILLGLVAVFVAVTGMKCMKCMEDDQVKKMRMAVFGGVIFIIAGLAALV ATSWYGNRVARAFYDPFTPVNTRFEFGSALFIGWAAASLAMLGGAFLCCSCPRRETSYPP TRGYPKNAPSTGKDYV NT seq 413 nt NT seq  +upstreamnt  +downstreamnt gcagtctgcaggccactcgggctttgatggtggctgcaatactcctgggccttgttgctg tatttgttgctgtgactggcatgaaatgcatgaagtgtatggaagatgaccaggtgaaga agatgcggatggctgtctttggtggggtgatcttcatcattgcaggtttggcagcgctgg tggccacgtcatggtatggcaacagagtggctcgggccttttatgaccctttcacccctg tcaataccagatttgagtttggatcagctctcttcattggctgggcagctgcttctctgg ccatgctggggggagcattcctctgctgctcctgtccacggagagaaacttcgtatccac ccacccgaggctatccaaaaaatgccccctccacagggaaggattatgtataa

DBGET integrated database retrieval system