Gavia stellata (red-throated loon): 104259682 Help Entry 104259682         CDS       T08384                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism gste  Gavia stellata (red-throated loon) Pathway gste04060   Cytokine-cytokine receptor interaction gste04218   Cellular senescence gste04620   Toll-like receptor signaling pathway gste04621   NOD-like receptor signaling pathway gste04622   RIG-I-like receptor signaling pathway gste05132   Salmonella infection gste05164   Influenza A Brite KEGG Orthology (KO) [BR:gste00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     104259682  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     104259682  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     104259682    04621 NOD-like receptor signaling pathway     104259682    04622 RIG-I-like receptor signaling pathway     104259682  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     104259682   09171 Infectious disease: bacterial    05132 Salmonella infection     104259682  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gste04052]     104259682    00536 Glycosaminoglycan binding proteins [BR:gste00536]     104259682 Cytokines and neuropeptides [BR:gste04052]  Cytokines   Chemokines    104259682 Glycosaminoglycan binding proteins [BR:gste00536]  Heparan sulfate / Heparin   Chemokines    104259682 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  104259682 NCBI-ProteinID:  XP_009813456 LinkDB All DBs Position Unknown AA seq 105 aa AA seqDB search MMTGKAVAAVLTLLLISAVGTKGKALPRSAIELRCQCVGTHSKFIHPKFIHNVNLIPSGP HCKNVEVIATLTDGREVCLEPTAPWVKLIIKAILDKANTKPETVS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgatgacaggcaaggctgtggctgctgtcctgactcttctcctgatctcagcggttgga acaaaaggtaaagccctgccacgctcagcgattgaactccggtgccagtgcgtaggcacc cattcgaagttcatccatcccaagttcattcataacgtgaacctcatccccagtggacct cactgcaagaacgttgaagtcatagctaccctgacagacggcagagaagtgtgcctggag cccactgctccctgggtgaagctgatcatcaaggcaattctggacaaggcaaacaccaaa cctgagacagtgtcctaa

DBGET integrated database retrieval system