Gavia stellata (red-throated loon): 104260191 Help Entry 104260191         CDS       T08384                                  Name (RefSeq) GTPase NRas   KO K07828   GTPase NRas Organism gste  Gavia stellata (red-throated loon) Pathway gste04010   MAPK signaling pathway gste04012   ErbB signaling pathway gste04068   FoxO signaling pathway gste04137   Mitophagy - animal gste04140   Autophagy - animal gste04150   mTOR signaling pathway gste04210   Apoptosis gste04218   Cellular senescence gste04370   VEGF signaling pathway gste04371   Apelin signaling pathway gste04540   Gap junction gste04625   C-type lectin receptor signaling pathway gste04810   Regulation of actin cytoskeleton gste04910   Insulin signaling pathway gste04912   GnRH signaling pathway gste04916   Melanogenesis Brite KEGG Orthology (KO) [BR:gste00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     104260191    04012 ErbB signaling pathway     104260191    04370 VEGF signaling pathway     104260191    04371 Apelin signaling pathway     104260191    04068 FoxO signaling pathway     104260191    04150 mTOR signaling pathway     104260191  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     104260191    04137 Mitophagy - animal     104260191   09143 Cell growth and death    04210 Apoptosis     104260191    04218 Cellular senescence     104260191   09144 Cellular community - eukaryotes    04540 Gap junction     104260191   09142 Cell motility    04810 Regulation of actin cytoskeleton     104260191  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     104260191   09152 Endocrine system    04910 Insulin signaling pathway     104260191    04912 GnRH signaling pathway     104260191    04916 Melanogenesis     104260191  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gste04131]     104260191   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gste04147]     104260191    04031 GTP-binding proteins [BR:gste04031]     104260191 Membrane trafficking [BR:gste04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     104260191  Endocytosis   Macropinocytosis    Ras GTPases     104260191 Exosome [BR:gste04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    104260191   Exosomal proteins of other body fluids (saliva and urine)    104260191   Exosomal proteins of breast cancer cells    104260191   Exosomal proteins of colorectal cancer cells    104260191 GTP-binding proteins [BR:gste04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     104260191 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf FeoB_N RsgA_GTPase MMR_HSR1 IL23 Motif Other DBs NCBI-GeneID:  104260191 NCBI-ProteinID:  XP_009814121 LinkDB All DBs Position Unknown AA seq 152 aa AA seqDB search DSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNSKSFADINLYR EQIKRVKDSDDVPMVLVGNKCDLPTRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFY TLVREIRQYRMKKLNSNEDGNQGCMGLSCIVM NT seq 459 nt NT seq  +upstreamnt  +downstreamnt gattcatatagaaagcaggttgttattgatggagagacatgcttgttagacattctggac actgcgggacaggaagagtacagtgccatgcgtgatcagtacatgaggactggggaagga ttcctctgtgtttttgccattaacaacagtaaatcgtttgctgatattaacctttacaga gaacagatcaagagagtgaaagattcagatgatgtgccaatggtgctagttgggaataag tgtgatttgcccacaagaacagtagatacaaaacaggctcaagaattagcaaaaagctat ggaatccccttcatagaaacatctgctaaaacaagacagggtgtggaagatgctttttac acactggtgagagagatccggcagtaccggatgaaaaagctcaacagcaatgaagacgga aatcaaggctgtatgggattgtcttgcattgtgatgtga

DBGET integrated database retrieval system