Gavia stellata (red-throated loon): 104264147 Help Entry 104264147         CDS       T08384                                  Name (RefSeq) profilin-2   KO K05759   profilin Organism gste  Gavia stellata (red-throated loon) Pathway gste04810   Regulation of actin cytoskeleton gste05132   Salmonella infection Brite KEGG Orthology (KO) [BR:gste00001]  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     104264147  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     104264147  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gste04131]     104264147   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:gste04812]     104264147    04147 Exosome [BR:gste04147]     104264147 Membrane trafficking [BR:gste04131]  Others   Actin-binding proteins    Others     104264147 Cytoskeleton proteins [BR:gste04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      104264147 Exosome [BR:gste04147]  Exosomal proteins   Proteins found in most exosomes    104264147 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  104264147 NCBI-ProteinID:  XP_009819392 LinkDB All DBs Position Unknown AA seq 96 aa AA seqDB search PVEIDMIVGKDREGFFTNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVG RAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF NT seq 291 nt NT seq  +upstreamnt  +downstreamnt ccagtagaaatagatatgattgtaggaaaagaccgagagggtttcttcaccaatggtctg acccttggtgcaaagaagtgctctgtgatcagagatagcctgtatgtcgatggtgactgc acaatggacatcaggacaaagagtcaaggtggtgagccaacatacaatgttgctgtaggc agagctggccgagtcttggtctttgtaatgggcaaagaaggggtccatggaggcggattg aataagaaggcatactcaatggcaaaatacttgagagactctgggttctag

DBGET integrated database retrieval system