Geobacter sulfurreducens PCA: GSU1134 Help Entry GSU1134           CDS       T00155                                  Symbol zapA Name (GenBank) cell division protein ZapA   KO K09888   cell division protein ZapA Organism gsu  Geobacter sulfurreducens PCA Brite KEGG Orthology (KO) [BR:gsu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gsu03036]     GSU1134 (zapA) Chromosome and associated proteins [BR:gsu03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     GSU1134 (zapA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapA Motif Other DBs NCBI-ProteinID:  AAR34510 UniProt:  Q74E30 LinkDB All DBs Position 1218993..1219280 Genome browser AA seq 95 aa AA seqDB search MPDKQSHRIKVLGRELTVKSTSSAERVGEVEALVNRKLAEARAQVPVGDPQVPIILALMN LAETCISLSRELEEQRHAGGDKLRRLTRRIEDVLL NT seq 288 nt NT seq  +upstreamnt  +downstreamnt gtgcccgacaagcagtcccaccgcatcaaggtcctcgggcgcgagttgaccgttaaaagc acctcctcggcggagcgcgtgggcgaggttgaagcccttgtgaaccgtaagcttgcggag gcacgagcacaggtgccggtgggggaccctcaggttccgattatcctggcactcatgaat ctggctgaaacgtgtatttccctttccagggaacttgaagagcagcgtcatgctggtggc gacaagcttcggcggctgacgcgacgtattgaagatgtccttctgtga

DBGET integrated database retrieval system