Geobacter sulfurreducens PCA: GSU1604 Help Entry GSU1604           CDS       T00155                                  Symbol acpP-2 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gsu  Geobacter sulfurreducens PCA Pathway gsu01100   Metabolic pathways gsu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gsu00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GSU1604 (acpP-2)    00074 Mycolic acid biosynthesis     GSU1604 (acpP-2)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GSU1604 (acpP-2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  AAR34978 UniProt:  Q74CR8 LinkDB All DBs Position 1755715..1755948 Genome browser AA seq 77 aa AA seqDB search MSSIEKRVKEIVAEQLGVDEAQVTNDASFMDDLGADSLDTVELVMALEEEFDIEISDEDA EKIQNVQDAIDYITEHT NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtcgtcaatagaaaaaagagtcaaagagatcgtagccgaacaactcggcgtcgatgag gcgcaggttacgaacgatgcctcctttatggatgatctgggggccgactctcttgacact gtcgagctggtgatggctctcgaggaagagtttgatatcgagatttccgacgaggacgcc gagaaaatccaaaacgttcaggatgccatcgattacatcaccgagcacacctag

DBGET integrated database retrieval system