Geobacter sulfurreducens PCA: GSU3132 Help Entry GSU3132           CDS       T00155                                  Symbol hup Name (GenBank) histone-like protein   KO K03530   DNA-binding protein HU-beta Organism gsu  Geobacter sulfurreducens PCA Brite KEGG Orthology (KO) [BR:gsu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gsu03032]     GSU3132 (hup)    03036 Chromosome and associated proteins [BR:gsu03036]     GSU3132 (hup)    03400 DNA repair and recombination proteins [BR:gsu03400]     GSU3132 (hup) DNA replication proteins [BR:gsu03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     GSU3132 (hup) Chromosome and associated proteins [BR:gsu03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     GSU3132 (hup) DNA repair and recombination proteins [BR:gsu03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       GSU3132 (hup) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG DUF2267 HU-CCDC81_euk_2 HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AAR36523 UniProt:  Q747Y3 LinkDB All DBs Position complement(3435199..3435483) Genome browser AA seq 94 aa AA seqDB search MTKAELVDAVAKSANLTKAAADKAVGAVISAVSDALKKGDKVTLVGFGSFEVSTRKARTG RNPQTGKEIKIAAAKVPKFRPGKALKDAVAGKKK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atgaccaaagctgaacttgtggatgccgtagcgaaatctgccaacctgaccaaggcggcc gcagacaaggccgttggcgccgttatcagcgccgtcagcgacgcccttaagaagggtgac aaagtgaccctggtcggtttcggtagcttcgaggtgtccacccgcaaggcgcgcaccggc cgtaacccccagaccggcaaggagatcaagatcgctgccgccaaggttcccaagttccgt ccgggcaaggccctcaaggacgcggttgccggcaagaagaagtag

DBGET integrated database retrieval system