Geomonas subterranea: KP001_10375 Help Entry KP001_10375       CDS       T07936                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gsub  Geomonas subterranea Pathway gsub01100   Metabolic pathways gsub01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gsub00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KP001_10375 (acpP)    00074 Mycolic acid biosynthesis     KP001_10375 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KP001_10375 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 Ribosomal_L12_N Motif Other DBs NCBI-ProteinID:  QXE92887 LinkDB All DBs Position complement(2396873..2397106) Genome browser AA seq 77 aa AA seqDB search MASIEKRIKEIVAEQLGVDEAQVTNESSFMDDLGADSLDTVELVMALEEEFEIEISDEDA EKIQSVQDAIDYITDHT NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggcttcgatcgagaaacgcattaaagagatagtagctgagcagcttggtgttgacgag gctcaggtgaccaacgagtcctccttcatggatgacctgggcgccgactccctggatacc gtggaactggtgatggcccttgaagaggaattcgaaatcgagatctccgacgaggacgcc gagaagatccagtcggttcaggacgcaatcgactacatcactgatcacacctag

DBGET integrated database retrieval system