KEGG   Geobacillus thermoleovorans CCB_US3_UF5: GTCCBUS3UF5_37700
Entry
GTCCBUS3UF5_37700 CDS       T01676                                 
Name
(GenBank) ATP synthase epsilon chain
  KO
K02114  F-type H+-transporting ATPase subunit epsilon
Organism
gte  Geobacillus thermoleovorans CCB_US3_UF5
Pathway
gte00190  Oxidative phosphorylation
gte01100  Metabolic pathways
Module
gte_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:gte00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    GTCCBUS3UF5_37700
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:gte00194]
    GTCCBUS3UF5_37700
Photosynthesis proteins [BR:gte00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   GTCCBUS3UF5_37700
SSDB
Motif
Pfam: ATP-synt_DE_N ATP-synt_DE
Other DBs
NCBI-ProteinID: AEV21070
UniProt: A0ABM5MN28
LinkDB
Position
complement(3465530..3465931)
AA seq 133 aa
MKTIHVSVVTPDGPVYEDDVEMVSVKAKSGELGILPGHIPLVAPLEISAARLKKGGKTQY
IAVSGGFLEVRPDKVTILAQAAERAEDIDVLRAKAAKERAERRLQSQQDDIDFKRAELAL
KRAMNRLSVAEMK
NT seq 402 nt   +upstreamnt  +downstreamnt
atgaaaacgatccacgtgagcgtcgttactcctgatggcccggtgtacgaagacgatgtt
gagatggtcagcgtcaaagcgaaaagcggcgagctcggcattttgccggggcacattccg
cttgtcgccccgctcgagatcagcgcggcccggctgaaaaaaggcggcaaaacgcaatac
attgccgtcagcggcggctttttggaagtccgcccggacaaagtgacgattttggctcaa
gctgctgaacgggcggaggacattgacgtcctccgcgccaaagcggcgaaagagcgggcg
gagcgccgcctgcaaagccagcaggatgacatcgacttcaagcgggctgaactggcgtta
aaacgcgccatgaaccgtttgagtgttgcggaaatgaagtaa

DBGET integrated database retrieval system