KEGG   Parageobacillus thermoglucosidasius C56-YS93: Geoth_2560
Entry
Geoth_2560        CDS       T01531                                 
Name
(GenBank) response regulator receiver protein
  KO
K03413  two-component system, chemotaxis family, chemotaxis protein CheY
Organism
gth  Parageobacillus thermoglucosidasius C56-YS93
Pathway
gth02020  Two-component system
gth02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gth00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Geoth_2560
 09140 Cellular Processes
  09142 Cell motility
   02030 Bacterial chemotaxis
    Geoth_2560
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:gth02022]
    Geoth_2560
   02035 Bacterial motility proteins [BR:gth02035]
    Geoth_2560
Two-component system [BR:gth02022]
 CheA family
  CheA-CheYBV (chemotaxis)
   Geoth_2560
Bacterial motility proteins [BR:gth02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Geoth_2560
SSDB
Motif
Pfam: Response_reg Aldolase
Other DBs
NCBI-ProteinID: AEH48451
LinkDB
Position
complement(2488702..2489061)
AA seq 119 aa
MAKILIVDDAKFMRMTLSNIVKKANHEIVGEAENGKEAVELYRVLKPDIVIMDITMPVMN
GLEALRAIKREDANAKIIMCSAMGQQRMVVEAIEAGAADFIVKPFEESRVMEAVNRLLS
NT seq 360 nt   +upstreamnt  +downstreamnt
atggcgaaaattcttattgttgatgatgcgaaatttatgagaatgacattatccaacatt
gttaaaaaagcgaaccatgaaattgttggcgaagcggaaaacgggaaagaggctgtggaa
ttatatcgggtactaaagccggatattgtcattatggacattacgatgccagtgatgaat
gggctcgaagcgttgcgcgcgattaaacgagaagacgcgaatgcgaaaatcatcatgtgc
tcagcgatgggacagcagcgcatggtggtggaagcgatcgaagcgggagcggctgatttt
atcgtgaagccgtttgaagaaagccgtgtgatggaagcggtgaatcgtttattatcataa

DBGET integrated database retrieval system