Gluconobacter thailandicus: FXF46_10830 Help Entry FXF46_10830       CDS       T06199                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gti  Gluconobacter thailandicus Pathway gti01100   Metabolic pathways gti01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gti00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FXF46_10830    00074 Mycolic acid biosynthesis     FXF46_10830   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FXF46_10830 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  QEH96741 UniProt:  A0AAJ0VJI5 LinkDB All DBs Position complement(2320567..2320821) Genome browser AA seq 84 aa AA seqDB search MTDSVAGISGMIIEKLLANPKVPRDINGNSKIVEDLAFDSLAVMNFVMEIEDELDVSVPL DKLADIRTINDLAACLHTLKASQA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt atgactgacagcgtcgccggcatctccggcatgatcatcgaaaaactgctcgccaacccg aaagttccgcgggacatcaatggcaacagcaagatcgtcgaagatctggctttcgatagc ctggctgtcatgaacttcgtcatggaaattgaagacgaactggatgtttcagtcccgctg gacaagctggccgacatccggaccatcaacgatctggctgcatgcctgcatactctcaag gccagccaagcgtga

DBGET integrated database retrieval system