Geobacillus thermoleovorans KCTC 3570: GT3570_05600 Help Entry GT3570_05600      CDS       T04710                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gtk  Geobacillus thermoleovorans KCTC 3570 Pathway gtk01100   Metabolic pathways gtk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gtk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GT3570_05600    00074 Mycolic acid biosynthesis     GT3570_05600   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GT3570_05600 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF1493 SAPS Motif Other DBs NCBI-ProteinID:  AMV10422 UniProt:  A0A1C3D893 LinkDB All DBs Position 1105473..1105706 Genome browser AA seq 77 aa AA seqDB search MADVLERVTKIIVDRLGVDESQVTLEASFKDDLGADSLDIVELVMELEDEFNMEISDEEA EKIVTVGDAVNYIKSRL NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atggccgatgtattggaacgtgtaacgaaaatcatcgttgaccggctgggggttgacgaa tcgcaagtgacgctcgaagcgtcgtttaaggacgacctgggcgctgactcgctcgacatc gtcgaactcgtcatggaacttgaagatgaattcaacatggaaatttccgatgaagaggcg gaaaaaatcgtcacagtcggagacgctgtgaactacataaaaagtcgtctgtaa

DBGET integrated database retrieval system