Geobacillus thermoleovorans KCTC 3570: GT3570_07100 Help Entry GT3570_07100      CDS       T04710                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism gtk  Geobacillus thermoleovorans KCTC 3570 Pathway gtk01100   Metabolic pathways gtk01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gtk00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GT3570_07100    00074 Mycolic acid biosynthesis     GT3570_07100   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GT3570_07100 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding SHPRH_helical-1st Motif Other DBs NCBI-ProteinID:  AMV10713 LinkDB All DBs Position 1427327..1427566 Genome browser AA seq 79 aa AA seqDB search MGFSDFCQLIAEEAKVPVEQVTAESSFQNDLGVDSLQLVHLLVVLAEKLQLEIGQIPHDL DFRTVGGLYKSLVGKGEII NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggggttttctgacttttgccaattgattgctgaagaggcaaaagtgccggtggagcaa gtaaccgccgaatcttcgtttcaaaatgacttaggggttgattcgttgcaacttgttcat ttgcttgtcgtattggctgaaaagcttcagttagaaattgggcaaattcctcacgatttg gacttccgaaccgttggtggactgtacaagtcgttagttgggaaaggagaaataatatga

DBGET integrated database retrieval system