Geobacillus thermocatenulatus: GT3921_09005
Help
Entry
GT3921_09005 CDS
T05178
Name
(GenBank) oxidoreductase
Organism
gtm
Geobacillus thermocatenulatus
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
GFO_IDH_MocA
GFO_IDH_MocA_C
GFO_IDH_MocA_C3
F420_oxidored
CoA_binding
NAD_binding_3
Motif
Other DBs
NCBI-ProteinID:
ASS99163
UniProt:
A0A226QBC5
LinkDB
All DBs
Position
1806542..1807621
Genome browser
AA seq
359 aa
AA seq
DB search
MGNTIPIRLGLIGAGGISKEHIKAALALPERVVLQAICDVNEQAAAEKAKTYGIREVYRD
YKELLASPDVDAVIITVPNFLHAQVSVDSLRAGKHVLCEKPMVTKAEEADAIIRARDESG
KQFMVALNNRFRQAAQWLHERIQSGAFGEIYYAKTGWVRRRGIPAWGAWFFDRERSGGGP
LIDLGVHMLDVTFWLLGNPNPVAVTGKTYAKFGPRRQGAWPGTAFLPNAVYTVEDFASAF
IQLENDATVLLETSWASHIEEERAYVEFLGTEGGVRWEWNVADNRQEVKWFRNEHGVPAD
VTLHFDDQSERVALLDHFVTSITEKTTPLCTAEQGLMIAKVLEAIYESSDQGRQVRIEW
NT seq
1080 nt
NT seq
+upstream
nt +downstream
nt
atgggaaacacgattccaatccgcctcggcttgattggagccggagggatttccaaagaa
catatcaaggcggcgctcgccctgcccgagcgcgtcgtcttgcaggcgatttgcgacgtc
aatgaacaagcggccgcggaaaaagcgaaaacgtacggcatccgtgaagtgtatcgcgac
tacaaggaattgctcgcctcaccagatgtcgatgccgtcatcattaccgtgccgaatttt
ttgcacgcccaagtgtcagtcgacagcttgcgggccgggaaacacgtgctttgcgaaaag
ccgatggtgacgaaagcggaagaggcggacgccatcatccgcgcccgcgacgaatcggga
aaacagtttatggttgcgctgaacaaccgcttccgccaagcggcgcaatggctgcatgag
cgaatccaatccggtgcgttcggcgagatttattacgcgaaaacgggctgggtgcgccgc
cgcggcattcccgcatggggggcatggttttttgaccgcgagcgctccggcggcggtccg
ctcattgacctgggcgtccatatgctcgatgtgaccttttggctgctcggcaatccgaac
ccggttgccgtgacggggaaaacgtacgcgaagttcggcccgcgccgccaaggggcatgg
ccgggaacggcgtttttgcctaatgccgtctatacggtcgaagatttcgcctcggcgttc
atccagctcgaaaacgacgcgacggtgctgctggagacgagctgggcgtcgcacattgaa
gaagagcgggcgtatgtcgaatttctcggcacggaaggcggcgtgcgctgggagtggaat
gtggctgacaaccgccaagaagtgaaatggttccgcaacgaacacggcgttccggccgat
gtcacgctccattttgacgaccaaagcgaacgggtggcgctccttgaccactttgtcacg
agcatcacggagaagacgacaccgctttgcacggcggaacaagggcttatgatcgccaaa
gtgttggaagcgatttacgagtcgtccgaccaagggcggcaagtccgcattgaatggtga
DBGET
integrated database retrieval system