KEGG   Geobacillus thermocatenulatus: GT3921_13550
Entry
GT3921_13550      CDS       T05178                                 
Name
(GenBank) signal recognition particle-docking protein FtsY
  KO
K03110  fused signal recognition particle receptor
Organism
gtm  Geobacillus thermocatenulatus
Pathway
gtm02024  Quorum sensing
gtm03060  Protein export
gtm03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:gtm00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    GT3921_13550
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    GT3921_13550
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    GT3921_13550
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:gtm02044]
    GT3921_13550
Secretion system [BR:gtm02044]
 Sec (secretion) system
  Prokaryotic Sec-SRP core components
   GT3921_13550
SSDB
Motif
Pfam: SRP54 SRP54_N AAA_22 AAA_16 ABC_tran MeaB CbiA AAA_17 AAA_30 APS_kinase Thymidylate_kin Peripla_BP_4 AAA_31 NACHT VirC1 Zeta_toxin nSTAND3 AAA YqeC AAA_7 DUF1002 AAA_19 AAA_33 MobB Glu_dehyd_C RsgA_GTPase Apolipoprotein AAA_14 AAA_5 KdpD NTPase_1 ArsA_ATPase
Other DBs
NCBI-ProteinID: ASS99969
UniProt: A0A226Q1Z7
LinkDB
Position
complement(2765795..2766781)
AA seq 328 aa
MGFFQKWKEKWTKQADAVTEKFKEGLSKTRNSLAGKVNDLIARYRKVDEAFFEELEEILI
AADVGVTTVMELVDELKMEVKRRNIQDPAQMRDVIAEKLVDIYRAGADDKELSALNIQEG
GLTVMLFVGVNGVGKTTTIGKLAHKLKSEGKSVLLAAGDTFRAGAIEQLEAWGKRVGVDV
IKQAAGSDPAAVMYDAIQAAKARGVDVLLCDTAGRLQNKVNLMKELEKVKRVISREIPGA
PHEVLLVLDATTGQNAMSQAKLFKEATDVTGIVLTKLDGTAKGGIVLAIRNEMAIPVKLV
GLGEKMDDLQVFDPEQYVYGLFADLLES
NT seq 987 nt   +upstreamnt  +downstreamnt
atgggtttttttcaaaaatggaaagaaaaatggacaaagcaagcggatgccgtaaccgaa
aagtttaaagaagggctgtcaaaaacgcgaaattcgctcgccgggaaagtgaacgacctc
atcgcccgttatcggaaagtggatgaagcgttttttgaagagcttgaggaaattttgatc
gccgccgatgtgggcgtcacgaccgtcatggaattggtcgatgagctgaaaatggaagtg
aagcgccgcaacattcaagacccggcgcaaatgcgcgacgtcatcgccgaaaagctcgtt
gacatttaccgcgccggcgccgatgacaaagaactttccgctttgaatatacaagaaggc
gggctgacggtcatgttgttcgtcggtgtcaacggcgtcggcaaaacgacaacgatcggc
aagctcgcccataagctgaaatcggaagggaaatccgtcttgttggcagctggcgacacg
ttccgcgccggggcgatcgagcagctcgaagcgtggggcaagcgcgttggggtcgacgtc
attaagcaggcggccggctccgatccggcagctgttatgtatgacgccattcaagcggcg
aaagcgcgcggcgttgacgtattgttatgcgacacggccggacggctgcaaaacaaagtg
aatttaatgaaagagctcgaaaaagtgaaacgtgtcattagccgcgaaattccgggcgct
ccgcatgaagtattgcttgtgttggatgcgacgaccgggcaaaacgcgatgagccaagcc
aagctgtttaaagaagcgaccgatgtgaccggcatcgtgttgacgaagcttgacggcacg
gcgaaaggcggcatcgtgctcgccattcgcaacgagatggccatcccggtgaaactcgtc
ggcctcggcgagaagatggacgatttgcaagtgttcgatccagaacagtacgtctacgga
ttgtttgctgatttgctggaatcatag

DBGET integrated database retrieval system