Gloeophyllum trabeum: GLOTRDRAFT_111579 Help Entry GLOTRDRAFT_111579 CDS       T03130                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism gtr  Gloeophyllum trabeum Pathway gtr03050   Proteasome gtr03440   Homologous recombination Brite KEGG Orthology (KO) [BR:gtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     GLOTRDRAFT_111579   09124 Replication and repair    03440 Homologous recombination     GLOTRDRAFT_111579  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:gtr03019]     GLOTRDRAFT_111579    04131 Membrane trafficking [BR:gtr04131]     GLOTRDRAFT_111579    03051 Proteasome [BR:gtr03051]     GLOTRDRAFT_111579    03400 DNA repair and recombination proteins [BR:gtr03400]     GLOTRDRAFT_111579 Messenger RNA biogenesis [BR:gtr03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      GLOTRDRAFT_111579 Membrane trafficking [BR:gtr04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     GLOTRDRAFT_111579 Proteasome [BR:gtr03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      GLOTRDRAFT_111579 DNA repair and recombination proteins [BR:gtr03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      GLOTRDRAFT_111579 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSS1_SEM1 Motif Other DBs NCBI-GeneID:  19299407 NCBI-ProteinID:  XP_007867512 JGI:  Glotr1_1_111579 UniProt:  S7Q3T2 LinkDB All DBs Position Unknown AA seq 107 aa AA seqDB search MSSEASTSKPAADTLAQNPEPSKDDESQPHLGVLEEDDEFEEFAVADWDDSQTDLAHLGG AAPGAAKSGGDKLWEDNWDDDDVEDDFSVQLRGELTKTGKGGDSMQQ NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgtcctcggaagcatctacgtcaaagccggctgcagatacccttgctcaaaacccggag ccctcgaaggacgatgaaagccagcctcaccttggcgttctcgaggaagacgatgaattc gaggagttcgctgttgcagattgggacgactcgcagactgacctggctcacctgggaggc gcggctcccggtgcggcaaagtctggaggagacaagttatgggaggacaattgggatgat gacgatgtcgaggatgatttcagcgtgcagctaaggggggagttaacaaagacgggcaag ggaggggattcgatgcagcagtag

DBGET integrated database retrieval system