Gloeophyllum trabeum: GLOTRDRAFT_117244 Help Entry GLOTRDRAFT_117244 CDS       T03130                                  Name (RefSeq) hypothetical protein   KO K11368   enhancer of yellow 2 transcription factor Organism gtr  Gloeophyllum trabeum Brite KEGG Orthology (KO) [BR:gtr00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:gtr03021]     GLOTRDRAFT_117244    03019 Messenger RNA biogenesis [BR:gtr03019]     GLOTRDRAFT_117244    03036 Chromosome and associated proteins [BR:gtr03036]     GLOTRDRAFT_117244 Transcription machinery [BR:gtr03021]  Eukaryotic type   RNA polymerase II system    Coactivators     SAGA/TFTC/STAGA complex      GLOTRDRAFT_117244 Messenger RNA biogenesis [BR:gtr03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      GLOTRDRAFT_117244 Chromosome and associated proteins [BR:gtr03036]  Eukaryotic type   Histone modification proteins    HAT complexes     SAGA complex      GLOTRDRAFT_117244 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EnY2 DUF3530 SpoIVA_C Motif Other DBs NCBI-GeneID:  19300312 NCBI-ProteinID:  XP_007868480 JGI:  Glotr1_1_117244 UniProt:  S7Q0G1 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MARAGGSTDELYAALHQRLVQSGDWDRIQGLLRTKLNESGWSDTVRAKAQDTARGMDPLS GRKLLELMKEDPQTRMTSVPEGVKKEVLAAIRQVIDKQFE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggcccgcgcaggcgggagcaccgacgagctctacgcagccctgcaccagcgcctcgtc cagagcggcgactgggaccgcatccaaggcctcttgcgcaccaagttgaatgagagcggg tggtcggatacggtacgcgcgaaagctcaagataccgcgcgcggtatggaccccctctcc gggcgtaagctgctcgaactgatgaaggaagacccgcagactcggatgacatctgtccct gagggcgtgaagaaagaggtcctggctgccatccgtcaggttatcgacaagcagtttgaa tag

DBGET integrated database retrieval system