Gloeophyllum trabeum: GLOTRDRAFT_48725 Help Entry GLOTRDRAFT_48725  CDS       T03130                                  Name (RefSeq) hypothetical protein   KO K10845   TFIIH basal transcription factor complex TTD-A subunit Organism gtr  Gloeophyllum trabeum Pathway gtr03022   Basal transcription factors gtr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:gtr00001]  09120 Genetic Information Processing   09121 Transcription    03022 Basal transcription factors     GLOTRDRAFT_48725   09124 Replication and repair    03420 Nucleotide excision repair     GLOTRDRAFT_48725  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:gtr03021]     GLOTRDRAFT_48725    03400 DNA repair and recombination proteins [BR:gtr03400]     GLOTRDRAFT_48725 Transcription machinery [BR:gtr03021]  Eukaryotic type   RNA polymerase II system    Basal transcription factors     TFIIH      GLOTRDRAFT_48725 DNA repair and recombination proteins [BR:gtr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TFIIH complex      GLOTRDRAFT_48725 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Tfb5 DUF5023 Motif Other DBs NCBI-GeneID:  19306596 NCBI-ProteinID:  XP_007869886 JGI:  Glotr1_1_48725 UniProt:  S7PW25 LinkDB All DBs Position Unknown AA seq 56 aa AA seqDB search DSAVKQILLSLNEKEGNSFIIEDLDDHHLVIKADEEYRVRRELEAELEKNTYSLEG NT seq 171 nt NT seq  +upstreamnt  +downstreamnt gactccgccgtcaaacagatcctgctctctctcaacgagaaggagggcaacagcttcatc atcgaggacctggacgaccaccacctcgtcatcaaggccgacgaggagtaccgggtgcgt agggagctcgaggccgagctggagaagaatacgtacagcttggaggggtga

DBGET integrated database retrieval system