Gloeophyllum trabeum: GLOTRDRAFT_53405 Help Entry GLOTRDRAFT_53405  CDS       T03130                                  Name (RefSeq) RNA polymerase   KO K03016   DNA-directed RNA polymerases I, II, and III subunit RPABC3 Organism gtr  Gloeophyllum trabeum Pathway gtr03020   RNA polymerase gtr03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:gtr00001]  09120 Genetic Information Processing   09121 Transcription    03020 RNA polymerase     GLOTRDRAFT_53405   09124 Replication and repair    03420 Nucleotide excision repair     GLOTRDRAFT_53405  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03021 Transcription machinery [BR:gtr03021]     GLOTRDRAFT_53405    03400 DNA repair and recombination proteins [BR:gtr03400]     GLOTRDRAFT_53405 Transcription machinery [BR:gtr03021]  Eukaryotic type   RNA polymerase II system    RNA polymerase II     Pol I, II, III common subunits      GLOTRDRAFT_53405   RNA polymerase III system    RNA polymerase III      GLOTRDRAFT_53405   RNA polymerase I system    RNA polymerase I      GLOTRDRAFT_53405 DNA repair and recombination proteins [BR:gtr03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     TCR (transcription coupled repair) factors      DNA-directed RNA polymerase II complex       GLOTRDRAFT_53405 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  RNA_pol_Rpb8 Motif Other DBs NCBI-GeneID:  19306925 NCBI-ProteinID:  XP_007860393 JGI:  Glotr1_1_53405 UniProt:  S7QMR3 LinkDB All DBs Position Unknown AA seq 157 aa AA seqDB search MASNSSNIVFDDIFTIEDIDKEGKKFDRVSRLYARSKNYDMHLTLDYNVELFPLQKDQSF ALALASSLVRGGAPAGGATEEEEKDKDVWRPDGKGRRGLEEDYDYVMYGKVYKFDGGTAE MVTAYASFGGLLMSLYGSFRHMTSIVLGDPVYLLMRK NT seq 474 nt NT seq  +upstreamnt  +downstreamnt atggcttcaaattcatcaaatattgtcttcgatgatattttcaccatcgaggatatagac aaggaggggaagaagttcgatcgcgtttctcgcctatatgcacgatctaagaactatgat atgcacttgaccctggactacaatgttgagctgttcccgttacagaaggatcaaagcttc gcactcgctttagcctcgtccctggttagaggaggcgcacctgctggaggcgctactgag gaagaggaaaaggacaaggatgtatggagaccggatgggaagggcagaagaggcttagag gaggactatgactacgtgatgtacggcaaggtgtacaaatttgacggtggaacggctgag atggttaccgcgtatgcgtccttcggtggtctcctcatgtcactctatggatctttccgg cacatgacaagtatcgtcctcggcgaccctgtatacctactgatgcgcaaataa

DBGET integrated database retrieval system