Gloeophyllum trabeum: GLOTRDRAFT_97614 Help Entry GLOTRDRAFT_97614  CDS       T03130                                  Name (RefSeq) protein translocase SEC6   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism gtr  Gloeophyllum trabeum Pathway gtr03060   Protein export gtr04141   Protein processing in endoplasmic reticulum gtr04145   Phagosome Brite KEGG Orthology (KO) [BR:gtr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GLOTRDRAFT_97614    04141 Protein processing in endoplasmic reticulum     GLOTRDRAFT_97614  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     GLOTRDRAFT_97614  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gtr04131]     GLOTRDRAFT_97614   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:gtr02044]     GLOTRDRAFT_97614 Membrane trafficking [BR:gtr04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     GLOTRDRAFT_97614 Secretion system [BR:gtr02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    GLOTRDRAFT_97614 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE CbtB Motif Other DBs NCBI-GeneID:  19310016 NCBI-ProteinID:  XP_007860834 JGI:  Glotr1_1_97614 UniProt:  S7QKT2 LinkDB All DBs Position Unknown AA seq 70 aa AA seqDB search MSEKVKEFIEVPQEFIRDGKQFLTRCTKPSQKEFTQICRAVAIGFAIIGFIGYFVKLIHI PINNILVGGA NT seq 213 nt NT seq  +upstreamnt  +downstreamnt atgtcggaaaaggtcaaagagttcatcgaagtaccgcaagagtttattagggatgggaag cagttcctcacccgctgcacaaaaccttcccagaaggagttcactcagatctgccgtgct gtcgccattggtttcgccatcataggtttcattgggtacttcgtgaagctgatccatatc cctatcaataatatcctagtgggaggtgcataa

DBGET integrated database retrieval system