Guillardia theta: GUITHDRAFT_101363 Help Entry GUITHDRAFT_101363 CDS       T02925                                  Name (RefSeq) hypothetical protein   KO K07342   protein transport protein SEC61 subunit gamma and related proteins Organism gtt  Guillardia theta Pathway gtt03060   Protein export gtt04141   Protein processing in endoplasmic reticulum gtt04145   Phagosome Brite KEGG Orthology (KO) [BR:gtt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     GUITHDRAFT_101363    04141 Protein processing in endoplasmic reticulum     GUITHDRAFT_101363  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     GUITHDRAFT_101363  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gtt04131]     GUITHDRAFT_101363   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:gtt02044]     GUITHDRAFT_101363 Membrane trafficking [BR:gtt04131]  Endoplasmic reticulum (ER) - Golgi transport   Others    SEC61 complex     GUITHDRAFT_101363 Secretion system [BR:gtt02044]  Sec (secretion) system   Eukaryotic Sec-SRP protein    GUITHDRAFT_101363 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  SecE DUF7314 Motif Other DBs NCBI-GeneID:  17309558 NCBI-ProteinID:  XP_005839893 JGI:  Guith1_101363 UniProt:  L1JXU6 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MAKDESDDALTQMVWGPAYAFYRDSKMLVRRCAKPDKNEFTKIALATGAGFLVMGFIGFF VKLMFIPINNVIVSNL NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggccaaggacgagtcggacgatgcgcttacgcagatggtgtggggaccagcatacgcg ttctacagagactcgaagatgctcgtgagaagatgcgccaagccagacaagaatgagttc accaagattgctcttgccaccggtgctggattccttgtgatgggattcatcggcttcttc gttaagctcatgttcattccgatcaacaatgtcatcgttagcaacttataa

DBGET integrated database retrieval system