Guillardia theta: GUITHDRAFT_109439 Help Entry GUITHDRAFT_109439 CDS       T02925                                  Name (RefSeq) hypothetical protein   KO K10881   26 proteasome complex subunit DSS1 Organism gtt  Guillardia theta Pathway gtt03050   Proteasome gtt03440   Homologous recombination Brite KEGG Orthology (KO) [BR:gtt00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03050 Proteasome     GUITHDRAFT_109439   09124 Replication and repair    03440 Homologous recombination     GUITHDRAFT_109439  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:gtt03019]     GUITHDRAFT_109439    04131 Membrane trafficking [BR:gtt04131]     GUITHDRAFT_109439    03051 Proteasome [BR:gtt03051]     GUITHDRAFT_109439    03400 DNA repair and recombination proteins [BR:gtt03400]     GUITHDRAFT_109439 Messenger RNA biogenesis [BR:gtt03019]  Eukaryotic type   mRNA surveillance and transport factors    Transport factors     TREX-2 complex      GUITHDRAFT_109439 Membrane trafficking [BR:gtt04131]  Exocytosis   Tethering complex    Exocyst complex assembly proteins     GUITHDRAFT_109439 Proteasome [BR:gtt03051]  Eukaryotic proteasome   Regulatory particles    PA700 (19S proteasome)     non-ATPase subunits      GUITHDRAFT_109439 DNA repair and recombination proteins [BR:gtt03400]  Eukaryotic type   DSBR (double strand breaks repair)    HR (homologous recombination)     Other HR factors      GUITHDRAFT_109439 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  DSS1_SEM1 DUF2947 Ribonuclease_T2 Motif Other DBs NCBI-GeneID:  17301375 NCBI-ProteinID:  XP_005831642 JGI:  Guith1_109439 UniProt:  L1J8J7 LinkDB All DBs Position Unknown AA seq 87 aa AA seqDB search MYMSGENDECDAWCGLSRPMSNNGSQAVEVEEDEFEEFMEDDWPVNRQEDTSLWDTEWDK EEVDEAFAAKLNAEIQQSASNAAAPAE NT seq 264 nt NT seq  +upstreamnt  +downstreamnt atgtacatgagtggggagaatgatgaatgcgacgcgtggtgcggcctttcacggcctatg tcaaacaacggatcgcaggcagtggaagtcgaggaagacgagttcgaggagtttatggag gatgattggccagtgaacaggcaggaggacacgtctctgtgggacaccgagtgggacaag gaggaggtggacgaggcgtttgccgccaagctcaacgcagagattcagcagagtgcgagc aacgcagcagcaccagcagagtga

DBGET integrated database retrieval system