Guillardia theta: GUITHDRAFT_116536 Help Entry GUITHDRAFT_116536 CDS       T02925                                  Name (RefSeq) hypothetical protein   KO K02183   calmodulin Organism gtt  Guillardia theta Pathway gtt04070   Phosphatidylinositol signaling system Brite KEGG Orthology (KO) [BR:gtt00001]  09130 Environmental Information Processing   09132 Signal transduction    04070 Phosphatidylinositol signaling system     GUITHDRAFT_116536  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:gtt01009]     GUITHDRAFT_116536   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gtt04131]     GUITHDRAFT_116536    03036 Chromosome and associated proteins [BR:gtt03036]     GUITHDRAFT_116536   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gtt04147]     GUITHDRAFT_116536 Protein phosphatases and associated proteins [BR:gtt01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      GUITHDRAFT_116536 Membrane trafficking [BR:gtt04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     GUITHDRAFT_116536 Chromosome and associated proteins [BR:gtt03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      GUITHDRAFT_116536 Exosome [BR:gtt04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    GUITHDRAFT_116536 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EH EF-hand_5 Dockerin_1 Motif Other DBs NCBI-GeneID:  17294017 NCBI-ProteinID:  XP_005824246 JGI:  Guith1_116536 UniProt:  L1ILY8 LinkDB All DBs Position Unknown AA seq 76 aa AA seqDB search MSTSRLNSEQWSHLREIWSLIDTDEDGKISTHDLLTLMKSFGYHHTEEEMNAFMDDLPVD RLRGVLSLDLETWRKD NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atgtctacttcaaggctgaacagtgaacaatggagccatctgcgggaaatctggagcttg atagacacggacgaggacggaaagatcagcacacatgatcttctaacattgatgaagtcc tttggatatcatcacacagaggaggagatgaatgctttcatggatgaccttccggtcgat cgacttcgtggagttcttagtctggatcttgaaacttggagaaaagattga

DBGET integrated database retrieval system