Guillardia theta: GUITHDRAFT_118433
Help
Entry
GUITHDRAFT_118433 CDS
T02925
Name
(RefSeq) hypothetical protein
KO
K06639
cell division cycle 14 [EC:
3.1.3.16
3.1.3.48
]
Organism
gtt
Guillardia theta
Brite
KEGG Orthology (KO) [BR:
gtt00001
]
09180 Brite Hierarchies
09181 Protein families: metabolism
01009 Protein phosphatases and associated proteins [BR:
gtt01009
]
GUITHDRAFT_118433
09183 Protein families: signaling and cellular processes
03037 Cilium and associated proteins [BR:
gtt03037
]
GUITHDRAFT_118433
Enzymes [BR:
gtt01000
]
3. Hydrolases
3.1 Acting on ester bonds
3.1.3 Phosphoric-monoester hydrolases
3.1.3.16 protein-serine/threonine phosphatase
GUITHDRAFT_118433
3.1.3.48 protein-tyrosine-phosphatase
GUITHDRAFT_118433
Protein phosphatases and associated proteins [BR:
gtt01009
]
Protein tyrosine phosphatases (PTPs)
Class I PTPs (Dual specificity phosphatases)
CDC14
GUITHDRAFT_118433
Cilium and associated proteins [BR:
gtt03037
]
Other cilia and associated proteins
Stereociliary proteins
GUITHDRAFT_118433
BRITE hierarchy
SSDB
Ortholog
Paralog
GFIT
Motif
Pfam:
DSPn
Antifungal_prot
Motif
Other DBs
NCBI-GeneID:
17292120
NCBI-ProteinID:
XP_005822395
JGI:
Guith1_118433
UniProt:
L1IHX9
LinkDB
All DBs
Position
Unknown
AA seq
210 aa
AA seq
DB search
MAAMMFCRGFDDLLPNSDTTAVKFFNVDERFVYESFFHDFGPINISQLYRYCQLIRTKLS
SLEGGKNCIVHCTSIDPKVCTNAAWLAGLSSIGCGWFHPGASALFVLVPLSSFLRWFASD
VFCVLKQSIGETVSNFGVSLLDCFKAIHLARKELFFDFSNFDPEEYEFFEKVENGDFNVI
TPKFIAFSNPTAVRTEICPGVFSKVSGKQR
NT seq
633 nt
NT seq
+upstream
nt +downstream
nt
atggcagcgatgatgttctgccgtgggtttgacgaccttttaccaaacagcgacacaacc
gcagtgaaatttttcaacgtggacgagcgatttgtatatgagagcttctttcatgacttc
ggaccgatcaacatctcgcagctttacagatactgtcaattgatccgcacgaaactatct
tcactcgagggaggaaaaaactgcatcgttcattgcacttcgatcgacccgaaagtttgc
acaaatgctgcatggctagcaggtctgtcttccattggctgtggatggtttcaccccgga
gcaagcgcactctttgttcttgtacctctctcctccttcctccgctggtttgcatctgac
gttttttgtgtgctgaagcaaagtattggagagacagtgagcaactttggtgtctcgttg
ctagattgcttcaaagccattcacctggctaggaaggaattattctttgacttttccaat
ttcgatcctgaagagtatgagttctttgagaaggttgagaatggagatttcaacgtcatc
actccaaagtttatcgcattcagcaacccaactgctgttcggaccgagatctgtccgggg
gttttctccaaggtgagcggaaaacagcgataa
DBGET
integrated database retrieval system