Guillardia theta: GUITHDRAFT_154731 Help Entry GUITHDRAFT_154731 CDS       T02925                                  Name (RefSeq) hypothetical protein   KO K13113   ubiquitin-like protein 5 Organism gtt  Guillardia theta Brite KEGG Orthology (KO) [BR:gtt00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03041 Spliceosome [BR:gtt03041]     GUITHDRAFT_154731   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:gtt04052]     GUITHDRAFT_154731 Spliceosome [BR:gtt03041]  Complex B   Other components    Complex B specific factors     GUITHDRAFT_154731 Cytokines and neuropeptides [BR:gtt04052]  Neuropeptides   Unclassified    GUITHDRAFT_154731 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Ubiquitin_2 Rad60-SLD Crinkler OTU1_UBXL Ubiquitin_4 Motif Other DBs NCBI-GeneID:  17295151 NCBI-ProteinID:  XP_005825336 JGI:  Guith1_154731 UniProt:  L1IQ03 LinkDB All DBs Position Unknown AA seq 73 aa AA seqDB search MIEVVCNDRLGKKIRVKCNPDDTIGDLKKLIAAQTGTRAEKIRLQKWYNIFKDHITLEDY EIKDGMGLELYYN NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atgatcgaggtggtctgcaacgatcgtcttggaaagaagatcagagtcaagtgcaacccc gacgacacaattggagacctcaagaagctcatcgctgctcagacaggcacccgcgcagag aagatcaggctgcagaaatggtacaacatcttcaaagatcacatcactctggaagattac gagattaaggatgggatgggccttgagctgtactacaactga

DBGET integrated database retrieval system