Guillardia theta: GUITHDRAFT_156873 Help Entry GUITHDRAFT_156873 CDS       T02925                                  Name (RefSeq) hypothetical protein   KO K10419   dynein light chain roadblock-type Organism gtt  Guillardia theta Pathway gtt04814   Motor proteins Brite KEGG Orthology (KO) [BR:gtt00001]  09140 Cellular Processes   09142 Cell motility    04814 Motor proteins     GUITHDRAFT_156873  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:gtt04131]     GUITHDRAFT_156873   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:gtt03037]     GUITHDRAFT_156873    04812 Cytoskeleton proteins [BR:gtt04812]     GUITHDRAFT_156873 Membrane trafficking [BR:gtt04131]  Endosome - Golgi transport   Rab GTPases and associated proteins    Rab associated proteins     GUITHDRAFT_156873 Cilium and associated proteins [BR:gtt03037]  Motile cilia and associated proteins   Dynein arm    GUITHDRAFT_156873 Cytoskeleton proteins [BR:gtt04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      GUITHDRAFT_156873 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Robl_LC7 LAMTOR5 Motif Other DBs NCBI-GeneID:  17311036 NCBI-ProteinID:  XP_005841495 JGI:  Guith1_156873 UniProt:  L1K238 LinkDB All DBs Position Unknown AA seq 100 aa AA seqDB search MNEVEETLRRLQGHKGVQGVVIVNQDGIPIRSTFDQSVTVQYASLITQLSSKARSAVREL DPQNDLTFLRVRSKKHEIMVAPDKDYLLIVIQDPNIMNTT NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgaatgaggtggaggagacgctgcggcggcttcaggggcacaagggggtgcagggggtg gtgatcgtgaaccaggacggcattcccatcagatcaaccttcgaccagtccgtcactgtg cagtacgcgagtttgatcacccagctttcaagcaaggcaaggagtgctgtccgagaactc gacccgcagaacgacctgacgtttctccgagtgcgatcgaaaaagcatgaaatcatggta gcacctgataaggactatctcctaatcgtgatacaggaccccaacatcatgaatacaaca taa

DBGET integrated database retrieval system