Guillardia theta: GUITHDRAFT_161471 Help Entry GUITHDRAFT_161471 CDS       T02925                                  Symbol RPA3 Name (RefSeq) replication protein A3, 14kDa   KO K10740   replication factor A3 Organism gtt  Guillardia theta Pathway gtt03030   DNA replication gtt03420   Nucleotide excision repair gtt03430   Mismatch repair gtt03440   Homologous recombination gtt03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:gtt00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     GUITHDRAFT_161471 (RPA3)    03420 Nucleotide excision repair     GUITHDRAFT_161471 (RPA3)    03430 Mismatch repair     GUITHDRAFT_161471 (RPA3)    03440 Homologous recombination     GUITHDRAFT_161471 (RPA3)    03460 Fanconi anemia pathway     GUITHDRAFT_161471 (RPA3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:gtt03032]     GUITHDRAFT_161471 (RPA3)    03400 DNA repair and recombination proteins [BR:gtt03400]     GUITHDRAFT_161471 (RPA3) DNA replication proteins [BR:gtt03032]  Eukaryotic type   DNA Replication Elongation Factors    RPA (replication protein A)     GUITHDRAFT_161471 (RPA3) DNA repair and recombination proteins [BR:gtt03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     RPA (replication factor A)      GUITHDRAFT_161471 (RPA3)    MMR (mismatch excision repair)      GUITHDRAFT_161471 (RPA3)   DSBR (double strand breaks repair)    HR (homologous recombination)      GUITHDRAFT_161471 (RPA3) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Rep_fac-A_3 Motif Other DBs NCBI-GeneID:  17308497 NCBI-ProteinID:  XP_005838906 JGI:  Guith1_161471 UniProt:  L1JTN7 LinkDB All DBs Position Unknown AA seq 114 aa AA seqDB search MEGARVNTQILAQELMAAQGSTEWSSGEHRVGRVKGAQNGQFVHLEGPDGGDIAIDRSSS SRHYGSEFVEVYGTVNNDRSVTEIRSTDFGNNFDLKLYNEAVLLSNGEMREIFH NT seq 345 nt NT seq  +upstreamnt  +downstreamnt atggagggagcgcgagtcaacacgcagattcttgcacaggagctcatggcagcacagggc agcacggaatggagttcaggagagcatagagtaggtcgggtgaagggtgcccagaacggt cagtttgtacaccttgaaggacccgatggaggcgacattgctatcgaccgctcctcgtcg tcaagacattacggctcagaattcgtggaggtgtatggaacagtcaataacgatcgctca gtcactgagatcaggtctactgattttggaaacaatttcgatttgaagctgtacaatgaa gcagtgctcttgagcaatggagaaatgagagaaattttccattag

DBGET integrated database retrieval system