Guillardia theta: GUITHDRAFT_44948 Help Entry GUITHDRAFT_44948  CDS       T02925                                  Name (RefSeq) hypothetical protein   KO K11251   histone H2A Organism gtt  Guillardia theta Pathway gtt03082   ATP-dependent chromatin remodeling Brite KEGG Orthology (KO) [BR:gtt00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     GUITHDRAFT_44948  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gtt03036]     GUITHDRAFT_44948   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:gtt04147]     GUITHDRAFT_44948 Chromosome and associated proteins [BR:gtt03036]  Eukaryotic type   Nucleosome assembly factors    Histones     GUITHDRAFT_44948 Exosome [BR:gtt04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    GUITHDRAFT_44948 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  17302826 NCBI-ProteinID:  XP_005832961 JGI:  Guith1_44948 UniProt:  L1JBT8 LinkDB All DBs Position Unknown AA seq 86 aa AA seqDB search GGKSVSRSKKAGLQFPVGRVHRYLKNGKYATRVGAGAPVYLAAVLEYLSAEVLELAGNAA RDNKKSRIIPRHIQLAVRNDEELNKL NT seq 258 nt NT seq  +upstreamnt  +downstreamnt ggaggcaagtccgtttcccgctccaagaaggctggacttcagttccccgttggacgtgtc caccgctacttgaagaacggcaagtacgccaccagggttggagctggtgcccccgtgtac ctcgccgctgtccttgagtacctctccgctgaggttcttgagttggctggcaacgctgct cgtgacaacaagaagtcccgtatcatcccccgtcacatccagttggccgtccgcaacgac gaggagttgaacaagctt

DBGET integrated database retrieval system