Geotalea uraniireducens: Gura_1878 Help Entry Gura_1878         CDS       T00521                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism gur  Geotalea uraniireducens Pathway gur01100   Metabolic pathways gur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Gura_1878    00074 Mycolic acid biosynthesis     Gura_1878   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Gura_1878 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF1493 Motif Other DBs NCBI-ProteinID:  ABQ26068 UniProt:  A5GF63 LinkDB All DBs Position 2179575..2179808 Genome browser AA seq 77 aa AA seqDB search MSSIDKRIKEIVAEQLGVDEGQVTNEASFMDDLGADSLDTVELVMALEEEFDIEISDEDA EKIQSVQDAIDYITDHT NT seq 234 nt NT seq  +upstreamnt  +downstreamnt atgtcatcgattgataaacggattaaagaaatagtagctgaacaactgggagtcgacgag gggcaggttaccaacgaggcttctttcatggatgaccttggcgccgactctctggacaca gtggagctggttatggctcttgaagaagaattcgacatcgaaatttccgatgaagatgcc gagaagatccagtcggtgcaggacgccatagattatatcactgatcatacctag

DBGET integrated database retrieval system