Geotalea uraniireducens: Gura_3121 Help Entry Gura_3121         CDS       T00521                                  Name (GenBank) hypothetical protein   KO K02398   negative regulator of flagellin synthesis FlgM Organism gur  Geotalea uraniireducens Pathway gur02020   Two-component system gur02040   Flagellar assembly Brite KEGG Orthology (KO) [BR:gur00001]  09130 Environmental Information Processing   09132 Signal transduction    02020 Two-component system     Gura_3121  09140 Cellular Processes   09142 Cell motility    02040 Flagellar assembly     Gura_3121  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02035 Bacterial motility proteins [BR:gur02035]     Gura_3121 Bacterial motility proteins [BR:gur02035]  Flagellar system   Flagellar assembly proteins    Others     Gura_3121 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  FlgM RRF_GI Motif Other DBs NCBI-ProteinID:  ABQ27282 UniProt:  A5G664 LinkDB All DBs Position complement(3688792..3689109) Genome browser AA seq 105 aa AA seqDB search MKIDDNSQSVVVELSRLQRVEQHAVEGDAKGAEPASKSLKSVDKVNISQSAERFNKTSNT LKGASDFSADKVNELKSKIEAGAYQVSSKDVAEKMLAALSKENDR NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgaaaatagacgataatagccagtcagtggtggtagaactttccaggcttcagagggta gagcaacatgcagtcgagggggacgccaagggtgccgaacccgcgtcaaagtcccttaaa agcgtcgacaaggtgaacatatcccaaagtgcagagcgtttcaacaaaaccagcaacacc ctgaagggcgcctccgatttcagtgccgacaaggttaatgaactgaaatcgaagatcgag gcaggcgcctaccaggtaagcagcaaggatgtggctgaaaagatgctggctgcgctgtcg aaagaaaacgatcgctag

DBGET integrated database retrieval system