Geotalea uraniireducens: Gura_3195 Help Entry Gura_3195         CDS       T00521                                  Name (GenBank) hypothetical protein   KO K02078   acyl carrier protein Organism gur  Geotalea uraniireducens Pathway gur01100   Metabolic pathways gur01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:gur00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Gura_3195    00074 Mycolic acid biosynthesis     Gura_3195   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Gura_3195 SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 Motif Other DBs NCBI-ProteinID:  ABQ27356 UniProt:  A5G6D8 LinkDB All DBs Position complement(3764700..3764942) Genome browser AA seq 80 aa AA seqDB search MHRNQIEQTVLSVLEAFLKCQLKLGDDICRQNASDWDSLKHIEIMFALEEELGVEFSQEE LAKLDSVVKIVDAVLAKHAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgcatcgcaatcagattgaacaaacagtgctgagcgtactcgaggcgtttctcaagtgc cagctaaagctcggtgacgacatttgtcgccagaatgcttccgattgggactcgctgaag cacattgaaatcatgttcgctctcgaagaagaattaggtgttgagttttcacaagaagaa ttggccaagcttgacagtgtggtcaaaatagttgacgcggtactggctaaacatgcggca taa

DBGET integrated database retrieval system